Recombinant Human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab83683)

Overview

Description

  • NatureRecombinant
  • SourceHEK 293 cells
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceTheoretical Sequence: ADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFL TKRSRQVCADPSEEWVQKYVSDLELSA
    • Amino acids27 to 92

Specifications

Our Abpromise guarantee covers the use of ab83683 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 95 % SDS-PAGE.

  • FormLyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C.

    Preservative: None
    Constituents: 10% Trehalose, 1% Human serum albumin, PBS

  • ReconstitutionIt is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. Working concentrations should be less than 100ng/ml to avoid aggregation. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended.

General Info

  • Alternative names
    • C C motif chemokine 3
    • CCL 3
    • CCL3
    • CCL3_HUMAN
    • Chemokine C C motif ligand 3
    • G0/G1 switch regulatory protein 19 1
    • G0/G1 switch regulatory protein 19-1
    • G0S19 1
    • G0S19 1 protein
    • Heparin binding chemotaxis protein
    • L2G25B
    • LD78 alpha
    • LD78-alpha(4-69)
    • LD78alpha
    • Macrophage inflammatory protein 1 alpha
    • Macrophage inflammatory protein 1-alpha
    • MIP 1 alpha
    • MIP 1A
    • MIP-1-alpha
    • MIP-1-alpha(4-69)
    • MIP1A
    • PAT 464.1
    • SCYA 3
    • SCYA3
    • SIS alpha
    • SIS beta
    • SIS-beta
    • Small inducible cytokine A3
    • small inducible cytokine A3 (homologous to mouse Mip-1a)
    • Small-inducible cytokine A3
    • Tonsillar lymphocyte LD78 alpha protein
    see all
  • FunctionMonokine with inflammatory and chemokinetic properties. Binds to CCR1, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T-cells. Recombinant MIP-1-alpha induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV).
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Post-translational
    modifications
    N-terminal processed form LD78-alpha(4-69) is produced by proteolytic cleavage after secretion from HTLV1-transformed T-cells.
  • Cellular localizationSecreted.
  • Information by UniProt

References for Recombinant Human Macrophage Inflammatory Protein 1 alpha / CCL3 (ab83683)

ab83683 has not yet been referenced specifically in any publications.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"