Recombinant Human Macrophage Inflammatory Protein 4 (ab101822)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP55774
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMQVGTNKELCCLVYTSWQIPQKFIVD YSETSPQCPKPGVILLTKRGRQICADPNKKWVQKYISDLKLNA
    • Molecular weight10 kDa including tags
    • Amino acids22 to 89
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101822 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography (Sephacryl S-200) with 20mM Tris pH 7.5, 2mM EDTA.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 10mM Sodium citrate, pH 3.5

General Info

  • Alternative names
    • Alternative macrophage activation associated CC chemokine 1
    • Alternative macrophage activation-associated CC chemokine 1
    • AMAC-1
    • AMAC1
    • CC chemokine PARC
    • CCL18
    • CCL18(4-69)
    • CCL18_HUMAN
    • CKb7
    • DC-CK1
    • DCCK1
    • Dendritic cell chemokine 1
    • Macrophage inflammatory protein 4
    • MIP-4
    • MIP4
    • PARC
    • Pulmonary and activation regulated chemokine
    • Pulmonary and activation-regulated chemokine
    • SCYA18
    • Small inducible cytokine A18
    • Small-inducible cytokine A18
    see all
  • FunctionChemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
  • Tissue specificityExpressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid.
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Macrophage Inflammatory Protein 4 images

  • SDS Page analysis of ab101822 (3ug)

References for Recombinant Human Macrophage Inflammatory Protein 4 (ab101822)

ab101822 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101822.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"