Recombinant Human CCL18 protein (ab9850)
Key features and details
- Expression system: Escherichia coli
- Purity: > 98% SDS-PAGE
- Suitable for: Functional Studies, SDS-PAGE
Description
-
Product name
Recombinant Human CCL18 protein
See all CCL18 proteins and peptides -
Purity
> 98 % SDS-PAGE.
Sterile filtered Greater than 98% pure by HPLC analyses. -
Expression system
Escherichia coli -
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
QVGTNKELCCLVYTSWQIPQKFIVDYSETSPQCPKPGVILLTKRGRQICA DPNKKWVQKYISDLKLNA -
Predicted molecular weight
10 kDa
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab9850 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Functional Studies
SDS-PAGE
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- Alternative macrophage activation associated CC chemokine 1
- Alternative macrophage activation-associated CC chemokine 1
- AMAC-1
see all -
Function
Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses. -
Tissue specificity
Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid. -
Sequence similarities
Belongs to the intercrine beta (chemokine CC) family. -
Cellular localization
Secreted. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (1)
ab9850 has been referenced in 1 publication.
- Kim H et al. Modeling G2019S-LRRK2 Sporadic Parkinson's Disease in 3D Midbrain Organoids. Stem Cell Reports 12:518-531 (2019). PubMed: 30799274