Recombinant human Macrophage Inflammatory Protein 4 (ab9850)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QVGTNKELCCLVYTSWQIPQKFLVDYSETSPQCPKPGVILLTKRGRQICA DPNKKWVQKYISDLKLNA
    • Molecular weight
      10 kDa

Associated products

Specifications

Our Abpromise guarantee covers the use of ab9850 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Form
    Lyophilised
  • Additional notes
    The biological activity of this product was determined by its ability to chemoattract human T-cells using a concentration range of 1.0-10.0 ng/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    n/a

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names
    • Alternative macrophage activation associated CC chemokine 1
    • Alternative macrophage activation-associated CC chemokine 1
    • AMAC-1
    • AMAC1
    • CC chemokine PARC
    • CCL18
    • CCL18(4-69)
    • CCL18_HUMAN
    • CKb7
    • DC-CK1
    • DCCK1
    • Dendritic cell chemokine 1
    • Macrophage inflammatory protein 4
    • MIP-4
    • MIP4
    • PARC
    • Pulmonary and activation regulated chemokine
    • Pulmonary and activation-regulated chemokine
    • SCYA18
    • Small inducible cytokine A18
    • Small-inducible cytokine A18
    see all
  • Function
    Chemotactic factor that attracts lymphocytes but not monocytes or granulocytes. May be involved in B-cell migration into B-cell follicles in lymph nodes. Attracts naive T-lymphocytes toward dendritic cells and activated macrophages in lymph nodes, has chemotactic activity for naive T-cells, CD4+ and CD8+ T-cells and thus may play a role in both humoral and cell-mediated immunity responses.
  • Tissue specificity
    Expressed at high levels in lung, lymph nodes, placenta, bone marrow, dendritic cells present in germinal centers and T-cell areas of secondary lymphoid organs and macrophages derived from peripheral blood monocytes. Not expressed by peripheral blood monocytes and a monocyte-to-macrophage differentiation is a prerequisite for expression. Expressed in synovial fluids from patients with rheumatoid and septic arthritis and in ovarian carcinoma ascitic fluid.
  • Sequence similarities
    Belongs to the intercrine beta (chemokine CC) family.
  • Cellular localization
    Secreted.
  • Information by UniProt

References

ab9850 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab9850.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up