Recombinant Human Macrophage inflammatory protein 5 (ab105617)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ16663
    • SpeciesHuman
    • SequenceMQFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSY FETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
    • Molecular weight10 kDa
    • Amino acids22 to 113

Specifications

Our Abpromise guarantee covers the use of ab105617 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Endotoxin level< 1.000 Eu/µg
  • Mass spectrometry
    MALDI-TOF
  • Purity> 95 % SDS-PAGE.
    ab105617 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, PBS, pH 7.4

General Info

  • Alternative names
    • C-C motif chemokine 15
    • CC chemokine 3
    • CCL15
    • CCL15(29-92)
    • CCL15_HUMAN
    • Chemokine (C C motif) ligand 15
    • Chemokine CC-2
    • Chemokine CC2
    • HCC-2
    • HCC2
    • HMRP 2B
    • HMRP2B
    • Leukotactin 1
    • Leukotactin-1
    • LKN-1
    • LKN1
    • Macrophage inflammatory protein 5
    • MIP 1D
    • MIP-1 delta
    • MIP-1D
    • MIP-5
    • MIP1 delta
    • MIP1d
    • MIP5
    • MRP 2B
    • Mrp-2b
    • Mrp2b
    • NCC-3
    • NCC3
    • New CC chemokine 3
    • OTTHUMP00000163955
    • SCYA15
    • SCYL3
    • Small inducible cytokine A15
    • Small inducible cytokine subfamily A (Cys Cys), member 15
    • Small-inducible cytokine A15
    • SY15
    see all
  • FunctionChemotactic factor that attracts T-cells and monocytes, but not neutrophils, eosinophils, or B-cells. Acts mainly via CC chemokine receptor CCR1. Also binds to CCR3. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are more potent chemoattractants than the small-inducible cytokine A15.
  • Tissue specificityMost abundant in heart, skeletal muscle and adrenal gland. Lower levels in placenta, liver, pancreas and bone marrow. CCL15(22-92), CCL15(25-92) and CCL15(29-92) are found in high levels in synovial fluids from rheumatoid patients.
  • Sequence similaritiesBelongs to the intercrine beta (chemokine CC) family.
  • Cellular localizationSecreted.
  • Information by UniProt

Recombinant Human Macrophage inflammatory protein 5 images

  • 15% SDS-PAGE analysis of 3µg ab105617.

References for Recombinant Human Macrophage inflammatory protein 5 (ab105617)

ab105617 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105617.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"