Recombinant Human Macrophage Scavenger Receptor I protein (ab112323)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP21757
    • SpeciesHuman
    • SequenceMEKRIQHILDMEANLMDTEHFQNFSMTTDQRFNDILLQLSTLFSSVQGHG NAIDEISKSLISLNTTLLDLQLNIENLNGKIQENTFKQQEEISKLEERVY
    • Molecular weight37 kDa including tags
    • Amino acids121 to 220
    • TagsGST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • FormLiquid
  • Additional notesBest use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.31% Glutathione

General Info

  • Alternative names
    • CD204
    • CD204 antigen
    • Macrophage acetylated LDL receptor I and II
    • Macrophage scavenger receptor 1
    • Macrophage scavenger receptor type III
    • Macrophage scavenger receptor types I and II
    • Msr 1
    • MSR1
    • MSRE_HUMAN
    • phSR1
    • phSR2
    • SCARA 1
    • SCARA1
    • Scavenger receptor class A member 1
    • Scavenger receptor type A
    • Scvr
    • SR A
    • SRA
    see all
  • FunctionMembrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL.
  • Tissue specificityIsoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
  • Sequence similaritiesContains 1 collagen-like domain.
    Contains 1 SRCR domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human Macrophage Scavenger Receptor I protein images

  • ab112323 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Macrophage Scavenger Receptor I protein (ab112323)

ab112323 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab112323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"