Recombinant Human Macrophage Scavenger Receptor I protein (ab169883)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASMTGGQQMGRGHHHHHHGNLYFQGGEKWETKNCSVSSTNANDITQSLT GKGNDSEEEMRFQEVFMEHMSNMEKRIQHILDMEANLMDTEHFQNFSMTT DQRFNDILLQLSTLFSSVQGHGNAIDEISKSLISLNTTLLDLQLNIENLN GKIQENTFKQQEEISKLEERVYNVSAEIMAMKEEQVHLEQEIKGEVKVLN NITNDLRLKDWEHSQTLRNITLIQGPPGPPGEKGDRGPTGESGPRGFPGP IGPPGLKGDRGAIGFPGSRGLPGYAGRPGNSGPKGQKGEKGSGNTLTPFT KVRLVGGSGPHEGRVEILHSGQWGTICDDRWEVRVGQVVCRSLGYPGVQA VHKAAHFGQGTGPIWLNEVFCFGRESSIEECKIRQWGTRACSHSEDAGVT CTL
    • Molecular weight
      44 kDa including tags
    • Amino acids
      77 to 451
    • Tags
      His-T7 tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab169883 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab169883 was expressed in E.coli as inclusion bodies, then refolded using “temperature shift inclusion body refolding” technology, chromatographically purified and sterile-filtered.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names
    • CD204
    • CD204 antigen
    • CD24
    • Macrophage acetylated LDL receptor I and II
    • Macrophage scavenger receptor 1
    • Macrophage scavenger receptor type III
    • Macrophage scavenger receptor types I and II
    • Msr 1
    • MSR1
    • MSRE_HUMAN
    • phSR1
    • phSR2
    • SCARA 1
    • SCARA1
    • Scavenger receptor class A member 1
    • Scavenger receptor class A, member 1
    • Scavenger receptor type A
    • Scvr
    • SR A
    • SRA
    see all
  • Function
    Membrane glycoproteins implicated in the pathologic deposition of cholesterol in arterial walls during atherogenesis. Two types of receptor subunits exist. These receptors mediate the endocytosis of a diverse group of macromolecules, including modified low density lipoproteins (LDL). Isoform III does not internalize actetylated LDL.
  • Tissue specificity
    Isoform I, isoform II and isoform III are expressed in monocyte-derived macrophages.
  • Sequence similarities
    Contains 1 collagen-like domain.
    Contains 1 SRCR domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

References

ab169883 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169883.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up