Overview

  • Product name
    Recombinant Human MAD1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      KEVFQTKIQEFRKACYTLTGYQIDITTENQYRLTSLYAEHPGDCLIFKAT SPSGSKMQLLETEFSHTVGELIEVHLRRQDSIPAFLSSLTLELFSRQTVA
    • Amino acids
      619 to 718
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160009 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • hMAD1
    • HsMAD1
    • MAD1
    • MAD1 mitotic arrest deficient like 1 (yeast)
    • MAD1-like protein 1
    • MAD1L1
    • MD1L1_HUMAN
    • Mitotic arrest deficient 1
    • Mitotic arrest deficient 1-like protein 1
    • Mitotic checkpoint MAD1 protein homolog
    • Mitotic spindle assembly checkpoint protein MAD1
    • PIG9
    • Tax binding protein 181
    • Tax-binding protein 181
    • TP53I9
    • Tumor protein p53 inducible protein 9
    • TXBP181
    see all
  • Function
    Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. May recruit MAD2L1 to unattached kinetochores. Has a role in the correct positioning of the septum. Required for anchoring MAD2L1 to the nuclear periphery. Binds to the TERT promoter and represses telomerase expression, possibly by interfering with MYC binding.
  • Tissue specificity
    Expressed weakly at G0/G1 and highly at late S and G2/M phase.
  • Involvement in disease
    Defects in MAD1L1 are involved in the development and/or progression of various types of cancer.
  • Sequence similarities
    Belongs to the MAD1 family.
  • Post-translational
    modifications
    Phosphorylated; by BUB1. Become hyperphosphorylated in late S through M phases or after mitotic spindle damage.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Cytoplasm > cytoskeleton > microtubule organizing center > centrosome. Cytoplasm > cytoskeleton > spindle. From the beginning to the end of mitosis, it is seen to move from a diffusely nuclear distribution to the centrosome, to the spindle midzone and finally to the midbody. Colocalizes with NEK2 at the kinetochore.
  • Information by UniProt

Images

  • ab160009 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160009 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160009.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up