Recombinant Human Mad2L1 protein (ab113604)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMALQLSREQGITLRGSAEIVAEFFSFGINS ILYQRGIYPSETFTRVQKYGLTLLVTTDLELIKYLNNVVEQLKDWLYKCS VQKLVVVISNIESGEVLERWQFDIECDKTAKDDSAPREKSQKAIQDEIRS VIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEE VRLRSFTTTIHKVNSMVAYKIPVND
    • Molecular weight
      26 kDa including tags
    • Amino acids
      1 to 205
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113604 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab113604 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • HsMAD 2
    • HsMAD2
    • MAD 2
    • MAD 2A
    • MAD2 like 1
    • MAD2 like protein 1
    • MAD2 mitotic arrest deficient like 1
    • MAD2-like protein 1
    • Mad2l1
    • MD2L1_HUMAN
    • Mitotic arrest deficient 2-like protein 1
    • Mitotic arrest deficient yeast homolog like 1
    • Mitotic spindle assembly checkpoint protein MAD2A
    see all
  • Function
    Component of the spindle-assembly checkpoint that prevents the onset of anaphase until all chromosomes are properly aligned at the metaphase plate. Required for the execution of the mitotic checkpoint which monitors the process of kinetochore-spindle attachment and inhibits the activity of the anaphase promoting complex by sequestering CDC20 until all chromosomes are aligned at the metaphase plate.
  • Sequence similarities
    Belongs to the MAD2 family.
    Contains 1 HORMA domain.
  • Domain
    The protein has two highly different native conformations, an inactive open conformation that cannot bind CDC20 and that predominates in cytosolic monomers, and an active closed conformation. The protein in the closed conformation preferentially dimerizes with another molecule in the open conformation, but can also form a dimer with a molecule in the closed conformation. Formation of a heterotetrameric core complex containing two molecules of MAD1L1 and of MAD2L1 in the closed conformation promotes binding of another molecule of MAD2L1 in the open conformation and the conversion of the open to the closed form, and thereby promotes interaction with CDC20.
  • Post-translational
    modifications
    Phosphorylated on multiple serine residues. The level of phosphorylation varies during the cell cycle and is highest during mitosis. Phosphorylation abolishes interaction with MAD1L1 and reduces interaction with CDC20.
  • Cellular localization
    Nucleus. Chromosome > centromere > kinetochore. Cytoplasm. Recruited by MAD1L1 to unattached kinetochores (Probable). Recruited to the nuclear pore complex by TPR during interphase. Recruited to kinetochores in late prometaphase after BUB1, CENPF, BUB1B and CENPE. Kinetochore association requires the presence of NEK2. Kinetochore association is repressed by UBD.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab113604 (3 µg) at approximately 25.7 kDa.

References

ab113604 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab113604.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up