Overview

  • Product nameRecombinant Human MADH7 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO15105
    • SpeciesHuman
    • SequenceCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPP PYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRS H
    • Molecular weight37 kDa including tags
    • Amino acids160 to 260

Specifications

Our Abpromise guarantee covers the use of ab114358 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 ug/ul. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CRCS3
    • FLJ16482
    • hSMAD 7
    • hSMAD7
    • MAD
    • MAD (mothers against decapentaplegic Drosophila) homolog 7
    • Mad homolog 7
    • MAD homolog 8
    • MAD mothers against decapentaplegic homolog 7
    • MADH 7
    • MADH 8
    • MADH6
    • MADH8
    • Mothers Against Decapentaplegic Drosophila Homolog of 6
    • Mothers Against Decapentaplegic Drosophila Homolog of 7
    • Mothers against decapentaplegic homolog 7
    • Mothers against decapentaplegic homolog 8
    • Mothers against DPP homolog 7
    • Mothers against DPP homolog 8
    • SMA- AND MAD-RELATED PROTEIN 7
    • SMAD
    • SMAD 7
    • SMAD family member 7
    • SMAD, mothers against DPP homolog 7
    • SMAD, mothers against DPP homolog 7 (Drosophila)
    • SMAD6
    • Smad7
    • SMAD7_HUMAN
    see all
  • FunctionAntagonist of signaling by TGF-beta (transforming growth factor) type 1 receptor superfamily members; has been shown to inhibit TGF-beta (Transforming growth factor) and activin signaling by associating with their receptors thus preventing SMAD2 access. Functions as an adapter to recruit SMURF2 to the TGF-beta receptor complex. Also acts by recruiting the PPP1R15A-PP1 complex to TGFBR1, which promotes its dephosphorylation. Positively regulates PDPK1 kinase activity by stimulating its dissociation from the 14-3-3 protein YWHAQ which acts as a negative regulator.
  • Tissue specificityUbiquitous with higher expression in the lung and vascular endothelium.
  • Involvement in diseaseColorectal cancer 3
  • Sequence similaritiesBelongs to the dwarfin/SMAD family.
    Contains 1 MH1 (MAD homology 1) domain.
    Contains 1 MH2 (MAD homology 2) domain.
  • Post-translational
    modifications
    Phosphorylation on Ser-249 does not affect its stability, nuclear localization or inhibitory function in TGFB signaling; however it affects its ability to regulate transcription (By similarity). Phosphorylated by PDPK1.
    Ubiquitinated by WWP1 (By similarity). Polyubiquitinated by RNF111, which is enhanced by AXIN1 and promotes proteasomal degradation. In response to TGF-beta, ubiquitinated by SMURF1; which promotes its degradation.
    Acetylation prevents ubiquitination and degradation mediated by SMURF1.
  • Cellular localizationNucleus. Cytoplasm. Interaction with NEDD4L or RNF111 induces translocation from the nucleus to the cytoplasm (PubMed:16601693). TGF-beta stimulates its translocation from the nucleus to the cytoplasm. PDPK1 inhibits its translocation from the nucleus to the cytoplasm in response to TGF-beta (PubMed:17327236).
  • Information by UniProt

Recombinant Human MADH7 protein images

  • 12.5% SDS-PAGE showing ab114358 at approximately 36.74kDa stained with Coomassie Blue.

References for Recombinant Human MADH7 protein (ab114358)

ab114358 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114358.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"