Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSEGESQTVLSSGSDPKVESSSSAPGLTSVSPPVTSTTSAASPEEEEESE DESEILEESPCGRWQKRREEVNQRNVPGIDSAYLAMDTEEGVEVVWNEVQ FSERKNYKLQEEKVRAVFDNLIQLEHLNIVKFHKYWADIKENKARVIFIT EYMSSGSLKQFLKKTKKNHKTMNEKAWKRWCTQILSALSYLHSCDPPIIH GNLTCDTIFIQHNGLIKIGSVAPDTINNHVKTCREEQKNLHFFAPEYGEV TNVTTAVDIYSFGMCALEMAVLEIQGNGESSYVPQEAISSAIQLLEDPLQ REFIQKCLQSEPARRPTARELLFHPALFEVPSLKLLAAHCIVGHQHMIPE NALEEITKNMDTSAVLAEIPAGPGREPVQTLYSQSPALELDKFLEDVRNG IYPLTAFGLPRPQQPQQEEVTSPVVPPSVKTPTPEPAEVETRKVVLMQCN IESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFIS EADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS
    • Amino acids
      1 to 535
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCON3
    • MADM
    • MUDPNP
    • Multiple domain putative nuclear protein
    • Myeloid leukemia factor 1 adaptor molecule
    • NRBP
    • NRBP_HUMAN
    • NRBP1
    • Nuclear receptor binding protein
    • Nuclear receptor-binding protein
    see all
  • Function
    May play a role in subcellular trafficking between the endoplasmic reticulum and Golgi apparatus through interactions with the Rho-type GTPases. Binding to the NS3 protein of dengue virus type 2 appears to subvert this activity into the alteration of the intracellular membrane structure associated with flaviviral replication.
  • Tissue specificity
    Ubiquitously expressed in all tissues examined with high levels in the testis.
  • Sequence similarities
    Belongs to the protein kinase superfamily. Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Domain
    The protein kinase domain is predicted to be catalytically inactive.
  • Cellular localization
    Cytoplasm > cell cortex. Endomembrane system. Cell projection > lamellipodium. Colocalizes with activated RAC3 to endomembranes and at the cell periphery in lamellipodia.
  • Information by UniProt

Images

  • ab162292 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up