Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTLKVQEYPTLKVPYETLNKRFRAAQKNIDREASHVTMVVAELEKTLSGC PAVDSVVSLLDGVVEELSVLKRKAVESIQAEDESAKLCKRRIEHLKEHSS DQPAAASVWKRKRMDRMMVEHLLRCGYYNTAVKLARQSGIEDLVNIEMFL TAKEVEESLERRETATCLAWCHDNKSRLRKMKSCLEFSLRIQEFIELIRQ NKRLDAVRHARKHFSQAEGSQLDEVRQAMGMLAFPPDTHISPYKDLLDPA RWRMLIQQFRYDNYRLHQLGNNSVFTLTLQAGLSAIKTPQCYKEDGSSKS PDCPVCSRSLNKLAQPLPMAHCANSRLVCKISGDVMNENNPPMMLPNGYV YGYNSLLSIRQDDKVVCPRTKEVFHFSQAEKVYIM
    • Amino acids
      1 to 385
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160933 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 1110030D19Rik
    • Cell proliferation inducing gene 5 protein
    • Cell proliferation-inducing gene 5 protein
    • EMLP
    • EMP
    • Erythroblast macrophage protein
    • GID complex subunit 9 FYV10 homolog
    • GID9
    • HLC 10
    • HLC-10
    • HLC10
    • Human lung cancer oncogene 10 protein
    • Lung cancer related protein 10
    • Macrophage erythroblast attacher
    • MAEA
    • MAEA_HUMAN
    • MGC93683
    • PIG5
    • Proliferation inducing gene 5
    see all
  • Function
    Plays a role in erythroblast enucleation and in the development of the mature macrophages. Mediates the attachment of erythroid cell to mature macrophages, in correlation with the presence of MAEA at cell surface of mature macrophages; This MAEA-mediated contact inhibits erythroid cells apoptosis. Participates to erythroblastic island formation, which is the functional unit of definitive erythropoiesis. Associates with F-actin to regulate actin distribution in erythroblasts and macrophages. May contribute to nuclear architecture and cells division events.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 CTLH domain.
    Contains 1 LisH domain.
  • Developmental stage
    Localized with condensed chromatin at prophase; Detected in nuclear spindle poles at metaphase and in the contractile ring during telophase and cytokinesis.
  • Cellular localization
    Nucleus matrix. Cell membrane. Cytoplasm, cytoskeleton. Localized as nuclear speckled-like pattern.
  • Information by UniProt

Images

  • ab160933 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160933 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160933.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up