Overview

  • Product name
    Recombinant Human MAF1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMKLLENSSFEAINSQLTVETGDAHIIGRIE SYSCKMAGDDKHMFKQFCQEGQPHVLEALSPPQTSGLSPSRLSKSQGGEE EGPLSDKCSRKTLFYLIATLNESFRPDYDFSTARSHEFSREPSLSWVVNA VNCSLFSAVREDFKDLKPQLWNAVDEEICLAECDIYSYNPDLDSDPFGED GSLWSFNYFFYNKRLKRIVFFSCRSISGSTYTPSEAGNELDMELGEEEVE EESRSRGSGAEETSTMEEDRVPVICI
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 256
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111643 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab111643 is purified using conventional chromatography.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituent: 10% Glycerol
    Note: Contains 90% Tris-HCl buffer.

General Info

  • Alternative names
    • Homolog of yeast MAF1
    • maf1
    • MAF1 homolog
    • MAF1 homolog (S. cerevisiae)
    • MAF1_HUMAN
    • MGC20332
    • MGC31779
    • MGC39758
    • Repressor of RNA polymerase III transcription MAF1 homolog
    see all
  • Function
    Element of the mTORC1 signaling pathway that acts as a mediator of diverse signals and that represses RNA polymerase III transcription. Inhibits the de novo assembly of TFIIIB onto DNA.
  • Sequence similarities
    Belongs to the MAF1 family.
  • Post-translational
    modifications
    Phosphorylated at Ser-60, Ser-68 and Ser-75; the major sites of phosphorylation. Nuclear accumulation correlates with a concomitant dephosphorylation. Phosphorylation may attenuate its RNA polymerase III-repressive function.
  • Cellular localization
    Nucleus. Cytoplasm.
  • Information by UniProt

Recombinant Human MAF1 protein images

  • 15% SDS-PAGE analysis of ab111643 (3 µg).

References for Recombinant Human MAF1 protein (ab111643)

ab111643 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111643.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up