Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAELSMGPELPTSPLAMEYVNDFDLLKFDVKKEPLGRAERPGRPCTRLQ PAG
    • Amino acids
      1 to 53
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153027 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Kreisler
    • Kreisler (mouse) maf related leucine zipper homolog
    • Kreisler maf related leucine zipper homolog
    • KRML
    • MAF bZIP transcription factor B
    • Maf-B
    • Mafb
    • MAFB/Kreisler basic region/leucine zipper transcription factor
    • MAFB_HUMAN
    • MGC43127
    • Segmentation protein KR
    • Transcription factor MafB
    • V maf musculoaponeurotic fibrosarcoma oncogene homolog B (avian)
    • V-maf musculoaponeurotic fibrosarcoma oncogene homolog B
    see all
  • Function
    Acts as a transcriptional activator or repressor. Plays a pivotal role in regulating lineage-specific hematopoiesis by repressing ETS1-mediated transcription of erythroid-specific genes in myeloid cells. Required for monocytic, macrophage, podocyte and islet beta cell differentiation. Involved in renal tubule survival and F4/80 maturation. Activates the insulin and glucagon promoters. Together with PAX6, transactivates weakly the glucagon gene promoter through the G1 element. SUMO modification controls its transcriptional activity and ability to specify macrophage fate. Binds element G1 on the glucagon promoter (By similarity). Involved either as an oncogene or as a tumor suppressor, depending on the cell context.
  • Tissue specificity
    Ubiquitous.
  • Involvement in disease
    Defects in MAFB are the cause of multicentric carpotarsal osteolysis syndrome (MCTO) [MIM:166300]. MCTO is a rare skeletal disorder, usually presenting in early childhood with a clinical picture mimicking juvenile rheumatoid arthritis. Progressive destruction of the carpal and tarsal bone usually occurs and other bones may also be involved. Chronic renal failure is a frequent component of the syndrome. Mental retardation and minor facial anomalies have been noted in some patients.
  • Sequence similarities
    Belongs to the bZIP family. Maf subfamily.
    Contains 1 bZIP domain.
  • Domain
    The leucine-zipper domain is involved in the interaction with LRPICD.
  • Post-translational
    modifications
    Phosphorylated by GSK3 and MAPK13 on serine and threonine residues.
    Sumoylated. Sumoylation on Lys-32 and Lys-297 stimulates its transcriptional repression activity and promotes macrophage differentiation from myeloid progenitors.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab153027 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153027 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153027.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up