Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPEL RPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
    • Molecular weight
      36 kDa including tags
    • Amino acids
      119 to 208

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GMA
    • MAG
    • MAG_HUMAN
    • Myelin associated glycoprotein
    • Myelin-associated glycoprotein
    • S MAG
    • S-MAG
    • Sialic acid binding Ig like lectin 4A
    • Sialic acid binding immunoglobulin like lectin 4A
    • Siglec 4a
    • Siglec-4a
    • SIGLEC4A
    • SPG75
    see all
  • Function
    Adhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3-linked sialic acid.
  • Sequence similarities
    Belongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab114422 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References

ab114422 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up