Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP20916
    • SpeciesHuman
    • SequenceGDLGGYNQYTFSEHSVLDIVNTPNIVVPPEVVAGTEVEVSCMVPDNCPEL RPELSWLGHEGLGEPAVLGRLREDEGTWVQVSLLHFVPTR
    • Molecular weight36 kDa including tags
    • Amino acids119 to 208

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114422 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GMA
    • MAG
    • MAG_HUMAN
    • Myelin associated glycoprotein
    • Myelin-associated glycoprotein
    • S MAG
    • S-MAG
    • Sialic acid binding Ig like lectin 4A
    • Sialic acid binding immunoglobulin like lectin 4A
    • Siglec 4a
    • Siglec-4a
    • SIGLEC4A
    • SPG75
    see all
  • FunctionAdhesion molecule in postnatal neural development that mediates sialic-acid dependent cell-cell interactions between neuronal and myelinating cells. Preferentially binds to alpha-2,3-linked sialic acid.
  • Sequence similaritiesBelongs to the immunoglobulin superfamily. SIGLEC (sialic acid binding Ig-like lectin) family.
    Contains 4 Ig-like C2-type (immunoglobulin-like) domains.
    Contains 1 Ig-like V-type (immunoglobulin-like) domain.
  • Cellular localizationMembrane.
  • Information by UniProt

Recombinant Human MAG protein images

  • ab114422 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MAG protein (ab114422)

ab114422 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114422.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"