Recombinant Human MAGEA10 protein (ab158845)

Overview

  • Product name
    Recombinant Human MAGEA10 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPRAPKRQRCMPEEDLQSQSETQGLEGAQAPLAVEEDASSSTSTSSSFPS SFPSSSSSSSSSCYPLIPSTPEEVSADDETPNPPQSAQIACSSPSVVASL PLDQSDEGSSSQKEESPSTLQVLPDSESLPRSEIDEKVTDLVQFLLFKYQ MKEPITKAEILESVIKNYEDHFPLLFSEASECMLLVFGIDVKEVDPTGHS FVLVTSLGLTYDGMLSDVQSMPKTGILILILSIIFIEGYCTPEEVIWEAL NMMGLYDGMEHLIYGEPRKLLTQDWVQENYLEYRQVPGSDPARYEFLWGP RAHAEIRKMSLLKFLAKVNGSDPRSFPLWYEEALKDEEERAQDRIATTDD TTAMASASSSATGSFSYPE
    • Amino acids
      1 to 369
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158845 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 1.10
    • cancer/testis antigen family 1, member 10
    • CT1.10
    • MAGE 10 antigen
    • MAGE10
    • Melanoma antigen family A 10
    • Melanoma associated antigen 10
    see all
  • Relevance
    This gene is a member of the MAGEA gene family. The members of this family encode proteins with 50 to 80% sequence identity to each other. The promoters and first exons of the MAGEA genes show considerable variability, suggesting that the existence of this gene family enables the same function to be expressed under different transcriptional controls. The MAGEA genes are clustered at chromosomal location Xq28. They have been implicated in some hereditary disorders, such as dyskeratosis congenita. MAGEA10 contains one MAGE domain. Its function is not known, though it may play a role in embryonal development and tumor transformation or aspects of tumor progression. MAGEA10 is expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.

Images

  • ab158845 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158845 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158845.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up