Recombinant Human MAGEA11 protein (ab158846)

Overview

  • Product name
    Recombinant Human MAGEA11 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MPLEQRSQHCKPEEGLQAQEEDLGLVGAQALQAEEQEAAFFSSTLNVGTL EELPAAESPSPPQSPQEESFSPTAMDAIFGSLSDEGSGSQEKEGPSTSPD LIDPESFSQDILHDKIIDLVHLLLRKYRVKGLITKAEMLGSVIKNYEDYF PEIFREASVCMQLLFGIDVKEVDPTSHSYVLVTSLNLSYDGIQCNEQSMP KSGLLIIVLGVIFMEGNCIPEEVMWEVLSIMGVYAGREHFLFGEPKRLLT QNWVQEKYLVYRQVPGTDPACYEFLWGPRAHAETSKMKVLEYIANANGRD PTSYPSLYEDALREEGEGV
    • Amino acids
      1 to 319
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158846 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 1.11
    • cancer/testis antigen family 1, member 11
    • CT1.11
    • MAGE 11
    • MAGE 11 antigen
    • MAGE11
    • MAGEA 11
    • Melanoma antigen family A 11
    • Melanoma associated antigen 11
    • MGC10511
    see all
  • Relevance
    MAGEA11 (Melanoma antigen family A, 11) is a member of the MAGEA gene family. MAGEA proteins are expressed in melanomas and other cancers. MAGEA11 acts as androgen receptor co-regulator increasing androgen receptor activity by modulating the receptors interdomain interaction.
  • Cellular localization
    Cytoplasmic and Nuclear

Images

  • ab158846 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158846 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158846.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up