Recombinant Human MAGEA12 protein (ab116774)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPLEQRSQHCKPEEGLEAQGEALGLVGAQAPATEEQETASSSSTLVEVTL REVPAAESPSPPHSPQGASTLPTTINYTLWSQSDEGSSNEEQEGPSTFPD LETSFQVALSRKMAELVHFLLLKYRAREPFTKAEMLGSVIRNFQDFFPVI FSKASEYLQLVFGIEVVEVVRIGHLYILVTCLGLSYDGLLGDNQIVPKTG LLIIVLAIIAKEGDCAPEEKIWEELSVLEASDGREDSVFAHPRKLLTQDL VQENYLEYRQVPGSDPACYEFLWGPRALVETSYVKVLHHLLKISGGPHIS YPPLHEWAFREGEE
    • Molecular weight
      60 kDa including tags
    • Amino acids
      1 to 314

Specifications

Our Abpromise guarantee covers the use of ab116774 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 1.12
    • Cancer/testis antigen family 1 member 12
    • CT1.12
    • MAGAC_HUMAN
    • MAGE 12 antigen
    • MAGE-12 antigen
    • MAGE12
    • MAGE12 antigen
    • MAGE12F
    • MAGE12F antigen
    • MAGEA12
    • Melanoma antigen family A 12
    • Melanoma associated antigen 12
    • Melanoma-associated antigen 12
    see all
  • Function
    Not known, though may play a role in tumor transformation or aspects of tumor progression.
  • Tissue specificity
    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
  • Sequence similarities
    Contains 1 MAGE domain.
  • Information by UniProt

Recombinant Human MAGEA12 protein images

  • 12.5% SDS-PAGE showing ab116774 at approximately 60.61kDa stained with Coomassie Blue.

References for Recombinant Human MAGEA12 protein (ab116774)

ab116774 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116774.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up