Overview

  • Product name
    Recombinant Human MAGEA3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMPLEQRSQHCKPEEGLEARGEALGLVG AQAPATEEQEAASSSSTLVEVTLGEVPAAESPDPPQSPQGASSLPTTMNY PLWSQSYEDSSNQEEEGPSTFPDLESEFQAALSRKVAELVHFLLLKYRAR EPVTKAEMLGSVVGNWQYFFPVIFSKASSSLQLVFGIELMEVDPIGHLYI FATCLGLSYDGLLGDNQIMPKAGLLIIVLAIIAREGDCAPEEKIWEELSV LEVFEGREDSILGDPKKLLTQHFVQENYLEYRQVPGSDPACYEFLWGPRA LVETSYVKVLHHMVKISGGPHISYPPLHEWVLREGEE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 314
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab99958 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Antigen MZ2 D
    • Antigen MZ2-D
    • Cancer/testis antigen 1.3
    • Cancer/testis antigen family 1 member 3
    • CT1.3
    • HIP8
    • HYPD
    • MAGA3_HUMAN
    • MAGE 3 antigen
    • MAGE family member A3
    • MAGE-3 antigen
    • MAGE3
    • MAGEA3
    • MAGEA6
    • Melanoma antigen family A 3
    • Melanoma associated antigen 3
    • Melanoma-associated antigen 3
    • MGC1461
    see all
  • Function
    Proposed to enhance ubiquitin ligase activity of RING-type zinc finger-containing E3 ubiquitin-protein ligases. May enhance ubiquitin ligase activity of TRIM28 and stimulate p53/TP53 ubiquitination by TRIM28. Proposed to act through recruitment and/or stabilization of the Ubl-conjugating enzyme (E2) at the E3:substrate complex. May play a role in embryonal development and tumor transformation or aspects of tumor progression. In vitro promotes cell viability in melanoma cell lines. Antigen recognized on a melanoma by autologous cytolytic T-lymphocytes.
  • Tissue specificity
    Expressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta. Never expressed in kidney tumors, Leukemias and lymphomas.
  • Sequence similarities
    Contains 1 MAGE domain.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab99958 (3µg).

References

ab99958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab99958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up