Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP43358
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMSSEQKSQHCKPEEGVEAQEEALGLVGAQA PTTEEQEAAVSSSSPLVPGTLEEVPAAESAGPPQSPQGASALPTTISFTC WRQPNEGSSSQEEEGPSTSPDAESLFREALSNKVDELAHFLLRKYRAKEL VTKAEMLERVIKNYKRCFPVIFGKASESLKMIFGIDVKEVDPTSNTYTLV TCLGLSYDGLLGNNQIFPKTGLLIIVLGTIAMEGDSASEEEIWEELGVMG VYDGREHTVYGEPRKLLTQDWVQENYLEYRQVPGSNPARYEFLWGPRALA ETSYVKVLEHVVRVNARVRIAYPSLREAALLEEEEGV
    • Molecular weight37 kDa including tags
    • Amino acids1 to 317
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99138 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab99138 was purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 20mM Tris HCl, pH 8.0

General Info

  • Alternative names
    • Cancer/testis antigen 1.4
    • CT1.4
    • MAGA4_HUMAN
    • MAGE 4
    • MAGE 4 antigen
    • MAGE 41
    • MAGE 41 antigen
    • MAGE 4A
    • MAGE 4B
    • MAGE X2
    • MAGE X2 antigen
    • MAGE-4 antigen
    • MAGE-41 antigen
    • MAGE-X2 antigen
    • MAGE4
    • MAGE41
    • MAGE4A
    • MAGE4B
    • MAGEA 4
    • MAGEA4
    • Melanoma antigen family A 4
    • Melanoma associated antigen 4
    • Melanoma-associated antigen 4
    • MGC21336
    see all
  • FunctionNot known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • Tissue specificityExpressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.
  • Sequence similaritiesContains 1 MAGE domain.
  • Information by UniProt

Recombinant Human MAGEA4 protein images

  • 15% SDS-PAGE analysis of 3µg ab99138

References for Recombinant Human MAGEA4 protein (ab99138)

ab99138 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99138.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"