Recombinant Human MAGEA6 protein (ab116736)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43360
    • SpeciesHuman
    • SequenceMPLEQRSQHCKPEEGLEARGEALGLVGAQAPATEEQEAASSSSTLVEVTL GEVPAAESPDPPQSPQGASSLPTTMNYPLWSQSYEDSSNQEEEGPSTFPD LESEFQAALSRKVAKLVHFLLLKYRAREPVTKAEMLGSVVGNWQYFFPVI FSKASDSLQLVFGIELMEVDPIGHVYIFATCLGLSYDGLLGDNQIMPKTG FLIIILAIIAKEGDCAPEEKIWEELSVLEVFEGREDSIFGDPKKLLTQYF VQENYLEYRQVPGSDPACYEFLWGPRALIETSYVKVLHHMVKISGGPRIS YPLLHEWALREGEE
    • Molecular weight61 kDa including tags
    • Amino acids1 to 314

Specifications

Our Abpromise guarantee covers the use of ab116736 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cancer/testis antigen 1.6
    • Cancer/testis antigen family 1, member 6
    • CT1.6
    • MAGA6_HUMAN
    • MAGE 3b
    • MAGE 6 antigen
    • MAGE-6 antigen
    • MAGE3B
    • MAGE3B antigen
    • MAGE6
    • MAGEA6
    • Melanoma antigen family A 6
    • Melanoma associated antigen 6
    • Melanoma-associated antigen 6
    see all
  • FunctionNot known, though may play a role in tumor or aspects of tumor progression.
  • Tissue specificityExpressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes.
  • Sequence similaritiesContains 1 MAGE domain.
  • Information by UniProt

Recombinant Human MAGEA6 protein images

  • 12.5% SDS-PAGE of ab116736 stained with Coomassie Blue.

References for Recombinant Human MAGEA6 protein (ab116736)

ab116736 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116736.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"