Recombinant Human MAGEA9 protein (ab116810)

Overview

  • Product nameRecombinant Human MAGEA9 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP43362
    • SpeciesHuman
    • SequenceMSLEQRSPHCKPDEDLEAQGEDLGLMGAQEPTGEEEETTSSSDSKEEE VSAAGSSSPPQSPQGGASSSISVYYTLWSQFDEGSSSQEEEEPSSSVDPA QLEFMFQEALELKVAELVHFLLHKYRVKEPVTKAEMLESVIKNYKRYFPV IFGKASEFMQVIFGTDVKEVDPAGHSYILVTALGLSCDSMLGDGHSMPKA ALLIIVLGVILTKDNCAPEEVIWEALSVMGVYVGKEHMFYGEPRKLLTQD WVQENYLEYRQVPGSDPAHYEFLWGSKAHAETSYEKVINYLVMLNAREPI CYPSLYEEVLGEEQEGV
    • Molecular weight61 kDa including tags
    • Amino acids1 to 315

Specifications

Our Abpromise guarantee covers the use of ab116810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cancer/testis antigen 1.9
    • Cancer/testis antigen family 1 member 9
    • CT1.9
    • MAGA9_HUMAN
    • MAGE 9 antigen
    • MAGE-9 antigen
    • MAGE9
    • MAGEA9A
    • MAGEA9B
    • Melanoma antigen family A 9
    • Melanoma associated antigen 9
    • Melanoma-associated antigen 9
    • MGC8421
    see all
  • FunctionNot known, though may play a role in embryonal development and tumor transformation or aspects of tumor progression.
  • Tissue specificityExpressed in many tumors of several types, such as melanoma, head and neck squamous cell carcinoma, lung carcinoma and breast carcinoma, but not in normal tissues except for testes and placenta.
  • Sequence similaritiesContains 1 MAGE domain.
  • Information by UniProt

Recombinant Human MAGEA9 protein images

  • 12.5% SDS-PAGE showing ab116810 at approximately 60.76kDa.
    Stained with Coomassie Blue.

References for Recombinant Human MAGEA9 protein (ab116810)

ab116810 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"