Recombinant Human MAGEB10 protein (ab88941)

Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMPRGQKSKLRAREKRRQARGGLEDLIDALDILEEEEESPPSASACLKDVF QSSL DGASNNPHGLREAQSTSTSATAASHTRHPEGVNDQMEERPICTQ DLEATDSFPR GPVDEKVIILVHYLLYKYQMKEPITKADMLRNVTQMSK SQFPVILSRASEHLEL IFGLDLKEVEPNKHIYVLVNKLDLGCDAKLSD ETGVPKTGLLMTVLGIIFTNGN CVAEEEVWKVFNTMGLYDGIEHFMFG EPRKLLTKDLVKENYLEYQQVPNSDPPR YQFLWGPRAHAETSKMKVLE FLAKVNDTAPSEFSNWYTEALQDEEERARARVAA KARVSATAGARSKV KSSKSSQLQ

Specifications

Our Abpromise guarantee covers the use of ab88941 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    Affinity chromatography
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • FLJ32965
    • MAGBA_HUMAN
    • MAGE B10 antigen
    • MAGE family testis and tumor specific protein
    • MAGE-B10 antigen
    • MAGEB10
    • melanoma antigen family B, 10
    • Melanoma associated antigen B10
    • Melanoma-associated antigen B10
    • MGC120394
    • OTTHUMP00000043236
    see all
  • Sequence similaritiesContains 1 MAGE domain.
  • Information by UniProt

References for Recombinant Human MAGEB10 protein (ab88941)

ab88941 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88941.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"