Recombinant Human MAGEC1 protein (ab153028)

Overview

  • Product name
    Recombinant Human MAGEC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGDKDMPTAGMPSLLQSSSESPQSCPEGEDSQSPLQIPQSSPESDDTLYP LQSPQSRSEGEDSSDPLQRPPEGKDSQSPLQIPQSSPEGDDTQSPLQNSQ SSPEGKDSLSPLEISQSPPEGEDVQSPLQNPASSFFSSA
    • Amino acids
      1 to 139
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cancer/testis antigen 7.1
    • Cancer/testis antigen family 7 member 1
    • CT7
    • CT7.1
    • MAGC1_HUMAN
    • MAGE C1
    • MAGE C1 antigen
    • MAGE-C1 antigen
    • MAGEC1
    • melanoma antigen family C, 1
    • Melanoma associated antigen C1
    • Melanoma-associated antigen C1
    • MGC39366
    see all
  • Tissue specificity
    Expressed in testis and in tumors of a wide variety of histologic types.
  • Sequence similarities
    Contains 1 MAGE domain.
  • Information by UniProt

Images

  • ab153028 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up