Recombinant Human MAGED2 protein (ab161199)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AEASEKDSSSMMQTLLTVTQNVEVPETPKASKALEVSEDVKVSKASGVSK ATEVSKTPEAREAPATQASSTTQLTDTQVLAAENKSLAADTKKQNADPQA VTMPATETKK
    • Amino acids
      16 to 125
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161199 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BCG 1
    • HCA10
    • JCL 1
    • MAGE D
    • MAGE D2 antigen
    • Melanoma antigen family D 2
    • Melanoma associated antigen D2
    see all
  • Relevance
    MAGED2 is a member of the MAGED gene family. In contrast to the MAGEA and MAGEB genes, which have their entire coding sequences located in the last exon, the MAGED genes have their coding sequences located throughout multiple exons. Also, the MAGEA and MAGEB genes are silent in normal tissues with the exception of testis and placenta, whereas the MAGED genes are expressed ubiquitously.
  • Cellular localization
    Cytoplasmic

Images

  • ab161199 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161199 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161199.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up