Overview

  • Product name
    Recombinant Human MAGI1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SHSTQVLPEFPPAEAQAPDQTDSSGQKKPDPFKIWAQSRSMYENRPMSPS PASGLSKGEREREINSTNFGECPIPDYQEQDIFLWRKETGFGFRILGGN
    • Amino acids
      761 to 859
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160391 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AIP 3
    • AIP-3
    • AIP3
    • Atrophin 1 interacting protein 3
    • Atrophin-1-interacting protein 3
    • BAI1 associated protein 1
    • BAI1-associated protein 1
    • BAIAP 1
    • BAIAP1
    • BAP 1
    • BAP-1
    • BAP1
    • Gukmi1
    • MAGI 1
    • MAGI-1
    • MAGI1
    • MAGI1_HUMAN
    • MAGI1c
    • Membrane associated guanylate kinase inverted 1
    • membrane associated guanylate kinase WW and PDZ domain containing 1
    • Membrane-associated guanylate kinase
    • Membrane-associated guanylate kinase inverted 1
    • TNRC 19
    • TNRC19
    • Trinucleotide repeat containing gene 19
    • Trinucleotide repeat containing gene 19 protein
    • Trinucleotide repeat-containing gene 19 protein
    • WW and PDZ domain-containing protein 1
    • WW domain containing protein 3
    • WW domain-containing protein 3
    • WWP 3
    • WWP3
    see all
  • Function
    May play a role as scaffolding protein at cell-cell junctions. May regulate acid-induced ASIC3 currents by modulating its expression at the cell surface.
  • Tissue specificity
    Widely expressed with the exception of skeletal muscle. Isoform 1, isoform 2 and isoform 6 are highly expressed in colon, kidney, lung, liver, and pancreas. Isoform 5 is predominantly expressed in brain and heart. Isoform 3 and isoform 4 are highly expressed in pancreas and brain.
  • Sequence similarities
    Contains 1 guanylate kinase-like domain.
    Contains 6 PDZ (DHR) domains.
    Contains 2 WW domains.
  • Cellular localization
    Cell junction, tight junction. Cell membrane. Localizes to epithelial cells tight junctions.
  • Information by UniProt

Images

  • ab160391 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160391 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160391.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up