Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP61326
    • SpeciesHuman
    • SequenceMESDFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDVMIRKEA YVHKSVMEELKRIIDDSEITKEDDALWPPPDRVGRQELEIVIGDEHISFT TSKIGSLIDVNQSKDPEGLRVFYYLVQDLKCLVFSLIGLHFKIKPILEHH HHHH
    • Molecular weight18 kDa including tags
    • Amino acids1 to 146
    • TagsHis tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117170 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab117170 is purified by proprietary chromatographic techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.58% Sodium chloride, 20% Glycerol, 0.03% DTT

General Info

  • Alternative names
    • Mago nashi homolog proliferation associated (Drosophila)
    • Mago nashi protein homolog
    • magoh
    • MAGOHA
    • MGN_HUMAN
    • Protein mago nashi homolog
    see all
  • FunctionComponent of a splicing-dependent multiprotein exon junction complex (EJC) deposited at splice junction on mRNAs. The EJC is a dynamic structure consisting of a few core proteins and several more peripheral nuclear and cytoplasmic associated factors that join the complex only transiently either during EJC assembly or during subsequent mRNA metabolism. Core components of the EJC, that remains bound to spliced mRNAs throughout all stages of mRNA metabolism, functions to mark the position of the exon-exon junction in the mature mRNA and thereby influences downstream processes of gene expression including mRNA splicing, nuclear mRNA export, subcellular mRNA localization, translation efficiency and nonsense-mediated mRNA decay (NMD). Remains associated with the mRNA after its export to the cytoplasm and require translation of the mRNA for removal. The heterodimer MAGOH-RBM8A interacts with PYM that function to enhance the translation of EJC-bearing spliced mRNAs by recruiting them to the ribosomal 48S preinitiation complex.
  • Tissue specificityUbiquitous.
  • Sequence similaritiesBelongs to the mago nashi family.
  • Cellular localizationNucleus. Nucleus speckle. Cytoplasm. Detected in granule-like structures in the dendroplasm (By similarity). Travels to the cytoplasm as part of the exon junction complex (EJC) bound to mRNA. Colocalizes with the core EJC, THOC4, NXF1 and UAP56 in the nucleus and nuclear speckles.
  • Information by UniProt

References for Recombinant Human MAGOH protein (ab117170)

ab117170 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117170.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"