Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MNRYTTMRQLGDGTYGSVLMGKSNESGELVAIKRMKRKFYSWDECMNLRE VKSLKKLNHANVIKLKEVIRENDHLYFIFEYMKENLYQLMKDRNKLFPES VIRNIMYQILQGLAFIHKHGFFHRDMKPENLLCMGPELVKIADFGLAREL RSQPPYTDYVSTRWYRAPEVLLRSSVYSSPIDVWAVGSIMAELYMLRPLF PGTSEVDEIFKICQVLGTPKKSDWPEGYQLASSMNFRFPQCVPINLKTLI PNASNEAIQLMTEMLNWDPKKRPTASQALKHPYFQVGQVLGPSSNHLESK QSLNKQLQPLESKPSLVEVEPKPLPDIIDQVVGQPQPKTSQQPLQPIQPP QNLSVQQPPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTI FKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLS AHQFPTL
    • Amino acids
      1 to 457
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158852 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • intestinal cell kinase
    • dJ417M14.2
    • fj04c02
    • Ick
    • Mak
    • MAK_HUMAN
    • Male germ cell associated kinase
    • Male germ cell-associated kinase
    • male germ cell-associated kinase retinal-enriched isoform
    • OTTHUMP00000016025
    • Rck
    • RP62
    • Serine/threonine protein kinase MAK
    • Serine/threonine-protein kinase MAK
    • testicular secretory protein Li 28
    • wu:fj04c02
    • zgc:56603
    see all
  • Function
    Essential for the regulation of ciliary length and required for the long-term survival of photoreceptors (By similarity). Phosphorylates FZR1 in a cell cycle-dependent manner. Plays a role in the transcriptional coactivation of AR. Could play an important function in spermatogenesis. May play a role in chromosomal stability in prostate cancer cells.
  • Tissue specificity
    Expressed in prostate cancer cell lines at generally higher levels than in normal prostate epithelial cell lines. Isoform 1 is expressed in kidney, testis, lung, trachea, and retina. Isoform 2 is retina-specific where it is expressed in rod and cone photoreceptors.
  • Involvement in disease
    Defects in MAK are the cause of retinitis pigmentosa type 62 (RP62) [MIM:614181]. RP62 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. CDC2/CDKX subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated. Phosphorylated on serine and threonine residues.
  • Cellular localization
    Nucleus. Cytoplasm > cytoskeleton > centrosome. Cytoplasm > cytoskeleton > spindle. Midbody. Cell projection > cilium > photoreceptor outer segment. Photoreceptor inner segment. Localized in both the connecting cilia and the outer segment axonemes (By similarity). Localized uniformly in nuclei during interphase, to the mitotic spindle and centrosomes during metaphase and anaphase, and also to midbody at anaphase until telophase.
  • Information by UniProt

Images

  • ab158852 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158852 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158852.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up