Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      EDTVEDKQEVNVGKPLIAKLDMHRGLGRKTCFQTCLMSNGPYQSSAATSG GAGHYHSLQDPFHGVYHSHPGNPSNVTPADSCHCSRTPDAFISSFAHHAS
    • Amino acids
      685 to 784
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161190 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Caspase like protein
    • DKFZp434L132
    • IMD12
    • MALT 1
    • MALT associated translocation
    • MALT lymphoma associated translocation
    • MALT lymphoma-associated translocation
    • Malt1
    • MALT1 paracaspase
    • MALT1_HUMAN
    • MLT
    • MLT 1
    • MLT1
    • Mucosa associated lymphoid tissue lymphoma translocation gene 1
    • Mucosa associated lymphoid tissue lymphoma translocation protein 1
    • Mucosa-associated lymphoid tissue lymphoma translocation protein 1
    • Paracaspase
    • Paracaspase-1
    • PCASP1
    see all
  • Function
    Enhances BCL10-induced activation of NF-kappa-B. Involved in nuclear export of BCL10. Binds to TRAF6, inducing TRAF6 oligomerization and activation of its ligase activity. Has ubiquitin ligase activity. MALT1-dependent BCL10 cleavage plays an important role in T-cell antigen receptor-induced integrin adhesion.
  • Tissue specificity
    Highly expressed in peripheral blood mononuclear cells. Detected at lower levels in bone marrow, thymus and lymph node, and at very low levels in colon and lung.
  • Involvement in disease
    Note=A chromosomal aberration involving MALT1 is recurrent in low-grade mucosa-associated lymphoid tissue (MALT lymphoma). Translocation t(11;18)(q21;q21) with BIRC2. This translocation is found in approximately 50% of cytogenetically abnormal low-grade MALT lymphoma.
  • Sequence similarities
    Belongs to the peptidase C14B family.
    Contains 1 death domain.
    Contains 2 Ig-like C2-type (immunoglobulin-like) domains.
  • Cellular localization
    Cytoplasm > perinuclear region. Nucleus. Shuttles between the nucleus and cytoplasm. Found in perinuclear structures together with BCL10.
  • Information by UniProt

Images

  • ab161190 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161190 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161190.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up