Recombinant Human Mammaglobin A protein (ab115507)

Overview

  • Product name
    Recombinant Human Mammaglobin A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATT NAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
    • Molecular weight
      10 kDa including tags
    • Amino acids
      19 to 93
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 0.29% Sodium chloride, 0.69% Phosphate Buffer

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names
    • Mammaglobin 1
    • Mammaglobin-1
    • Mammaglobin-A
    • MGB1
    • Scgb2a2
    • Secretoglobin family 2A member 2
    • SG2A2
    • SG2A2_HUMAN
    • UGB2
    see all
  • Tissue specificity
    Mammary gland specific. Over-expressed in breast cancer.
  • Sequence similarities
    Belongs to the secretoglobin family. Lipophilin subfamily.
  • Information by UniProt

Images

  • 14% SDS-PAGE showing ab115507 at approximately 9.88kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References

ab115507 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab115507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up