Recombinant Human Mammaglobin A protein (ab115507)

Overview

  • Product name
    Recombinant Human Mammaglobin A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRGSHHHHHHGSGSGCPLLENVISKTINPQVSKTEYKELLQEFIDDNATT NAIDELKECFLNQTDETLSNVEVFMQLIYDSSLCDLF
    • Molecular weight
      10 kDa including tags
    • Amino acids
      19 to 93
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab115507 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Endotoxin level
    < 1.000 Eu/µg
  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 0.29% Sodium chloride, 0.69% Phosphate Buffer

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilized pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage. Reconstituted protein can be stored at 4°C for a week.

General Info

  • Alternative names
    • Mammaglobin 1
    • Mammaglobin-1
    • Mammaglobin-A
    • MGB1
    • Scgb2a2
    • Secretoglobin family 2A member 2
    • SG2A2
    • SG2A2_HUMAN
    • UGB2
    see all
  • Tissue specificity
    Mammary gland specific. Over-expressed in breast cancer.
  • Sequence similarities
    Belongs to the secretoglobin family. Lipophilin subfamily.
  • Information by UniProt

Recombinant Human Mammaglobin A protein images

  • 14% SDS-PAGE showing ab115507 at approximately 9.88kDa:
    Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa
    Lane 2: reduced and boiled sample, 5µg/lane.
    Lane 3: non-reduced and non-boiled sample, 5µg/lane.

References for Recombinant Human Mammaglobin A protein (ab115507)

ab115507 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab115507.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up