Recombinant Human Mammaglobin B protein (ab116887)

Overview

  • Product nameRecombinant Human Mammaglobin B protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO75556
    • SpeciesHuman
    • SequenceMKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFI DSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
    • Molecular weight37 kDa
    • Amino acids1 to 95

Specifications

Our Abpromise guarantee covers the use of ab116887 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Lacryglobin
    • LIPHC
    • Lipophilin C
    • Lipophilin-C
    • LPHC
    • LPNC
    • Mammaglobin 2
    • Mammaglobin-2
    • Mammaglobin-B
    • MGB2
    • MGC71973
    • Scgb2a1
    • Secretoglobin family 2A member 1
    • Secretoglobin, family 2A, member 1
    • SG2A1_HUMAN
    • UGB3
    see all
  • FunctionMay bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones.
  • Tissue specificityExpressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
  • Sequence similaritiesBelongs to the secretoglobin family. Lipophilin subfamily.
  • Information by UniProt

Recombinant Human Mammaglobin B protein images

  • 12.5% SDS-PAGE showing ab116887 at approximately 36.52kDa, stained with Coomassie Blue.

References for Recombinant Human Mammaglobin B protein (ab116887)

ab116887 has not yet been referenced specifically in any publications.

Product Wall

Thank you for your reply. I apologize, but I have not been able to get any information from the testing lab regarding antibodies used to test the protein ab116887 in ELISA. Due to the lack of data and information, I have removed ELISA as a tested appli...

Read More

Thank you for your reply. The testing laboratory does not have these antibodies commercially available either, but I have asked them for any additional information regarding their characteristics, and I will let you know as soon as I hear back. We have...

Read More

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"