Recombinant Human Mannose Phosphate Isomerase protein (denatured) (ab111629)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionP34949
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARL LASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQD SLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYP DANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQL HQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSD NTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPP VPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQ RGGVLFIGANESVSLKLTEPKDLLIFRACCLL
    • Molecular weight42 kDa including tags
    • Amino acids1 to 362
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.

  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea

General Info

  • Alternative names
    • PMI1
    • CDG1B
    • FLJ39201
    • Mannose 6 phosphate isomerase
    • Mannose-6-phosphate isomerase
    • MANNOSEPHOSPHATE ISOMERASE
    • MGC94106
    • MPI
    • MPI_HUMAN
    • Phosphohexomutase
    • Phosphomannose isomerase
    • phosphomannose isomerase 1
    • PMI
    see all
  • FunctionInvolved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
  • Tissue specificityExpressed in all tissues, but more abundant in heart, brain and skeletal muscle.
  • PathwayNucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 1/2.
  • Involvement in diseaseDefects in MPI are the cause of congenital disorder of glycosylation type 1B (CDG1B) [MIM:602579]; also known as carbohydrate-deficient glycoprotein syndrome type Ib (CDGS1B). Congenital disorders of glycosylation are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1B is clinically characterized by protein-losing enteropathy.
  • Sequence similaritiesBelongs to the mannose-6-phosphate isomerase type 1 family.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Mannose Phosphate Isomerase protein (denatured) images

  • 15% SDS-PAGE showing ab111629 at approximately 41.9kDa (3µg).

References for Recombinant Human Mannose Phosphate Isomerase protein (denatured) (ab111629)

ab111629 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"