Recombinant Human Mannose Phosphate Isomerase protein (denatured) (ab111629)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAPRVFPLSCAVQQYAWGKMGSNSEVARL LASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQD SLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYP DANHKPEMAIALTPFQGLCGFRPVEEIVTFLKTAAGNNMEDIFGELLLQL HQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSD NTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPP VPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQ RGGVLFIGANESVSLKLTEPKDLLIFRACCLL
    • Molecular weight
      42 kDa including tags
    • Amino acids
      1 to 362
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111629 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 90 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 2.4% Urea

General Info

  • Alternative names
    • PMI1
    • CDG1B
    • FLJ39201
    • Mannose 6 phosphate isomerase
    • Mannose-6-phosphate isomerase
    • MANNOSEPHOSPHATE ISOMERASE
    • MGC94106
    • MPI
    • MPI_HUMAN
    • Phosphohexomutase
    • Phosphomannose isomerase
    • phosphomannose isomerase 1
    • PMI
    see all
  • Function
    Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.
  • Tissue specificity
    Expressed in all tissues, but more abundant in heart, brain and skeletal muscle.
  • Pathway
    Nucleotide-sugar biosynthesis; GDP-alpha-D-mannose biosynthesis; alpha-D-mannose 1-phosphate from D-fructose 6-phosphate: step 1/2.
  • Involvement in disease
    Defects in MPI are the cause of congenital disorder of glycosylation type 1B (CDG1B) [MIM:602579]; also known as carbohydrate-deficient glycoprotein syndrome type Ib (CDGS1B). Congenital disorders of glycosylation are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1B is clinically characterized by protein-losing enteropathy.
  • Sequence similarities
    Belongs to the mannose-6-phosphate isomerase type 1 family.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab111629 at approximately 41.9kDa (3µg).

References

ab111629 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab111629.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up