Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPY REDEEGAFGEHGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTA EAVAVLKGEQEKEAQHKDQTAALPLAAEETANLPPSPPPSPASEQTVTVE EAAGGESALAPSVFKQAKDKVSDGVTKSPEKRSSLPRPSSILPPRRGVSG DRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTPGSTAITPGTP PSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPAT PKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTS KCGSLKNIRHRPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVK IDSQKLNFREHAKARVDHGAEIITQSPGRSSVASPRRLSNVSSSGSINLL ESPQLATLAEDVTAALAKQGL
    • Molecular weight
      78 kDa including tags
    • Amino acids
      1 to 471
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114686 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp686I2148
    • MAP 2
    • MAP dendrite specific
    • MAP-2
    • MAP2
    • MAP2A
    • MAP2B
    • MAP2C
    • Microtubule associated protein 2
    • Microtubule-associated protein 2
    • MTAP2_HUMAN
    see all
  • Function
    The exact function of MAP2 is unknown but MAPs may stabilize the microtubules against depolymerization. They also seem to have a stiffening effect on microtubules.
  • Sequence similarities
    Contains 3 Tau/MAP repeats.
  • Post-translational
    modifications
    Phosphorylated at serine residues in K-X-G-S motifs by MAP/microtubule affinity-regulating kinase (MARK1 or MARK2), causing detachment from microtubules, and their disassembly (By similarity). Isoform 2 is probably phosphorylated by PKA at Ser-323, Ser-354 and Ser-386 and by FYN at Tyr-67.
  • Cellular localization
    Cytoplasm, cytoskeleton.
  • Information by UniProt

Recombinant Human MAP2 protein images

  • ab114686 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human MAP2 protein (ab114686)

ab114686 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114686.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up