Recombinant Human MAP2K1IP1 protein (ab102022)

Overview

  • Product name
    Recombinant Human MAP2K1IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGV PVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQV VQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 124
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102022 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 5mM DTT, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • LAMTOR3
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3
    • LTOR3_HUMAN
    • MAP2K1IP1
    • MEK binding partner 1
    • MEK partner 1
    • MEK-binding partner 1
    • Mitogen activated protein kinase kinase 1 interacting protein 1
    • Mitogen-activated protein kinase kinase 1-interacting protein 1
    • Mitogen-activated protein kinase scaffold protein 1
    • Mp1
    • Ragulator complex protein LAMTOR3
    see all
  • Function
    As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
  • Sequence similarities
    Belongs to the LAMTOR3 family.
  • Cellular localization
    Late endosome membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab102022.

References

ab102022 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab102022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up