Recombinant Human MAP2K1IP1 protein (ab102022)

Overview

  • Product name
    Recombinant Human MAP2K1IP1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMADDLKRFLYKKLPSVEGLHAIVVSDRDGV PVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQV VQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS
    • Molecular weight
      16 kDa including tags
    • Amino acids
      1 to 124
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab102022 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab102022 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 5mM DTT, 20mM Tris HCl, 100mM Sodium chloride, pH 8.0

General Info

  • Alternative names
    • LAMTOR3
    • Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3
    • LTOR3_HUMAN
    • MAP2K1IP1
    • MEK binding partner 1
    • MEK partner 1
    • MEK-binding partner 1
    • Mitogen activated protein kinase kinase 1 interacting protein 1
    • Mitogen-activated protein kinase kinase 1-interacting protein 1
    • Mitogen-activated protein kinase scaffold protein 1
    • Mp1
    • Ragulator complex protein LAMTOR3
    see all
  • Function
    As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.
  • Sequence similarities
    Belongs to the LAMTOR3 family.
  • Cellular localization
    Late endosome membrane.
  • Information by UniProt

Recombinant Human MAP2K1IP1 protein images

  • 15% SDS-PAGE analysis of 3µg ab102022.

References for Recombinant Human MAP2K1IP1 protein (ab102022)

ab102022 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab102022.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up