Recombinant Human MAP3K12 binding inhibitory protein 1 (ab172163)

Overview

  • Product name
    Recombinant Human MAP3K12 binding inhibitory protein 1
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAAATEHNRPSSGDRNLERRCSPNLSREVL YEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPALLFSALEQHIL YLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKH KESDLRDVKKTQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVR EFCNVIDCNQENSCARTDAIFTPYPGFKSHVKVSRVVYTYGPQTRPEGIP GSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLR KSREAESMATHHLPLEHHHHHH
    • Molecular weight
      43 kDa including tags
    • Amino acids
      1 to 344
    • Tags
      His tag C-Terminus , His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172163 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituent: 0.24% Tris

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names
    • MAP3K12 binding inhibitory protein 1
    • MAP3K12-binding inhibitory protein 1
    • MAPK upstream kinase binding inhibitory protein
    • MAPK upstream kinase-binding inhibitory protein
    • Mbip
    • MBIP1_HUMAN
    • MUK binding inhibitory protein
    • MUK-binding inhibitory protein
    • OTTHUMP00000178844
    see all
  • Function
    Inhibits the MAP3K12 activity to induce the activation of the JNK/SAPK pathway. Component of the ATAC complex, a complex with histone acetyltransferase activity on histones H3 and H4.
  • Tissue specificity
    Ubiquitous. High expression seen in the heart and lung.
  • Cellular localization
    Nucleus. Cytoplasm. Shows a cytoplasmic localization when coexpressed with MAP3K12.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172163.

    Lane 1: Non-reduced

    Lane 2: Reduced

References

ab172163 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172163.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up