Recombinant Human MAP3K4 protein (ab158877)

Overview

  • Product name
    Recombinant Human MAP3K4 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRH SSPTEERDEPAYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKS
    • Amino acids
      1201 to 1300
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158877 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • dJ473J16.1 (mitogen-activated protein kinase kinase kinase 4)
    • FLJ42439
    • KIAA0213
    • M3K4_HUMAN
    • MAP three kinase 1
    • MAP/ERK kinase kinase 4
    • MAP3K4
    • MAPK/ERK kinase kinase 4
    • MAPKKK4
    • MEK kinase 4
    • MEKK 4
    • MEKK4
    • Mitogen-activated protein kinase kinase kinase 4
    • MTK1
    • predicted protein of HQ0412
    • PRO0412
    • RP3-473J16.4
    • SSK2/SSK22 MAP kinase kinase kinase, yeast, homolog of
    see all
  • Function
    Component of a protein kinase signal transduction cascade. Activates the CSBP2, P38 and JNK MAPK pathways, but not the ERK pathway. Specifically phosphorylates and activates MAP2K4 and MAP2K6.
  • Tissue specificity
    Expressed at high levels in heart, placenta, skeletal muscle and pancreas, and at lower levels in other tissues.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Cellular localization
    Cytoplasm > perinuclear region. Localized in perinuclear vesicular-like structures, probably Golgi-associated vesicles.
  • Information by UniProt

Images

  • ab158877 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158877 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158877.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up