Recombinant Human MAP3K6 protein (ab160323)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      HFWLHFLLQSCQPFKTACAQGDQCLVLVLEMNKVLLPAKLEVRGTDPVST VTLSLLEPETQDIPSSWTFPVASICGVSASKRDERCCFLYALPPAQDVQL C
    • Amino acids
      225 to 325
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Apoptosis signal regulating kinase 2
    • Apoptosis signal-regulating kinase 2
    • ASK2
    • EC 2.7.11.25
    • M3K6_HUMAN
    • MAP3K6
    • MAPKKK6
    • MEKK6
    • MGC125653
    • MGC20114
    • Mitogen-activated protein kinase kinase kinase 6
    see all
  • Function
    Component of a protein kinase signal transduction cascade. Activates the JNK, but not ERK or p38 kinase pathways.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Information by UniProt

Images

  • ab160323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up