Recombinant Human MAP3K8 protein (ab152292)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      SLERNPNHRPRAADLLKHEALNPPREDQPRCQSLDSALLERKRLLSRKEL ELPENIADSSCTGSTEESEMLKRQRSLYIDLGALAGYFNLVRGPPTLEYG
    • Molecular weight
      37 kDa including tags
    • Amino acids
      368 to 467

Specifications

Our Abpromise guarantee covers the use of ab152292 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AURA2
    • c COT
    • Cancer Osaka thyroid oncogene
    • CCOT
    • COT
    • COT proto oncogene serine/threonine protein kinase
    • EST
    • ESTF
    • Ewing sarcoma transformant
    • FLJ10486
    • M3K8_HUMAN
    • MAP3K 8
    • MAP3K8
    • MEKK8
    • Mitogen activated protein kinase kinase kinase 8
    • Mitogen-activated protein kinase kinase kinase 8
    • Proto oncogene cCot
    • Proto-oncogene c-Cot
    • Serine/threonine protein kinase cot
    • Serine/threonine-protein kinase cot
    • TPL 2
    • TPL-2
    • TPL2
    • Tumor progression locus 2
    see all
  • Function
    Required for TLR4 activation of the MEK/ERK pathway. Able to activate NF-kappa-B 1 by stimulating proteasome-mediated proteolysis of NF-kappa-B 1/p105. Plays a role in the cell cycle. The longer form has some transforming activity, although it is much weaker than the activated cot oncoprotein.
  • Tissue specificity
    Expressed in several normal tissues and human tumor-derived cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
  • Developmental stage
    Isoform 1 is activated specifically during the S and G2/M phases of the cell cycle.
  • Post-translational
    modifications
    Autophosphorylated. Isoform 1 undergoes phosphorylation mainly on Ser residues, and isoform 2 on both Ser and Thr residues.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab152292 stained with Coomassie Blue.

References

ab152292 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152292.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up