Recombinant Human MAP3K9 protein (ab116944)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionP80192-4
    • SpeciesHuman
    • SequenceEFPRLPDPNVVFPPTPRRWNTQQDSTLERPKTLEFLPRPRPSANRQRLDP WWFVSPSHARSTSPANSSSTETPSNLDSCFASSSSTVEERPGLPALLPFQ AGPLPPTERT
    • Molecular weight38 kDa including tags
    • Amino acids971 to 1080

Specifications

Our Abpromise guarantee covers the use of ab116944 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • M3K9_HUMAN
    • Map3k9
    • MEKK9
    • Mitogen activated protein kinase kinase kinase 9
    • Mitogen-activated protein kinase kinase kinase 9
    • Mixed lineage kinase 1
    • Mixed lineage kinase 1 (tyr and ser/thr specificity)
    • MLK1
    • PRKE1
    see all
  • FunctionActivates the JUN N-terminal pathway.
  • Tissue specificityExpressed in epithelial tumor cell lines of colonic, breast and esophageal origin.
  • Sequence similaritiesBelongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase kinase subfamily.
    Contains 1 protein kinase domain.
    Contains 1 SH3 domain.
  • Post-translational
    modifications
    Autophosphorylation on serine and threonine residues within the activation loop plays a role in enzyme activation. Thr-312 is likely to be the main autophosphorylation site.
  • Information by UniProt

Recombinant Human MAP3K9 protein images

  • 12.5% SDS-PAGE showing ab116944 at approximately 37.73kDa stained with Coomassie Blue.

References for Recombinant Human MAP3K9 protein (ab116944)

ab116944 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116944.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"