Overview

  • Product name
    Recombinant Human MAP4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPL LDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 99

Specifications

Our Abpromise guarantee covers the use of ab114759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp779A1753
    • MAP-4
    • MAP4
    • MAP4_HUMAN
    • MGC8617
    • Microtubule associated protein 4
    • Microtubule-associated protein 4
    • OTTHUMP00000210723
    • OTTHUMP00000210725
    • OTTHUMP00000210727
    • OTTHUMP00000210730
    see all
  • Function
    Non-neuronal microtubule-associated protein. Promotes microtubule assembly.
  • Sequence similarities
    Contains 4 Tau/MAP repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylation on Ser-787 negatively regulates MAP4 activity to promote microtubule assembly. Isoform 3 is phosphorylated on Ser-337 and Ser-338.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114759 at approximately 36.96kDa.

References

ab114759 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up