Overview

  • Product name
    Recombinant Human MAP4 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MADLSLADALTEPSPDIEGEIKRDFIATLEAEAFDDVVGETVGKTDYIPL LDVDEKTGNSESKKKPCSETSQIEDTPSSKPTLLANGGHGVEGSDTTEA
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 99

Specifications

Our Abpromise guarantee covers the use of ab114759 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/ul.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DKFZp779A1753
    • MAP-4
    • MAP4
    • MAP4_HUMAN
    • MGC8617
    • Microtubule associated protein 4
    • Microtubule-associated protein 4
    • OTTHUMP00000210723
    • OTTHUMP00000210725
    • OTTHUMP00000210727
    • OTTHUMP00000210730
    see all
  • Function
    Non-neuronal microtubule-associated protein. Promotes microtubule assembly.
  • Sequence similarities
    Contains 4 Tau/MAP repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR (By similarity). Phosphorylation on Ser-787 negatively regulates MAP4 activity to promote microtubule assembly. Isoform 3 is phosphorylated on Ser-337 and Ser-338.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Recombinant Human MAP4 protein images

  • 12.5% SDS-PAGE Stained with Coomassie Blue showing ab114759 at approximately 36.96kDa.

References for Recombinant Human MAP4 protein (ab114759)

ab114759 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114759.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up