Recombinant Human MAP4K4 protein (ab152989)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      VHPALQRPAEPQVQWSHLASLKNNVSPVSRSHSFSDPSPKFAHHHLRSQD PCPPSRSEVLSQSSDSKSEAPDPTQKAWSRSDSDEVPPRVPVRTTSRSPV
    • Amino acids
      611 to 710
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152989 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • FLH21957
    • FLJ10410
    • FLJ20373
    • FLJ90111
    • Hepatocyte progenitor kinase like/germinal center kinase like kinase
    • HGK
    • HPK/GCK like kinase
    • HPK/GCK like kinase HGK
    • HPK/GCK-like kinase HGK
    • KIAA0687
    • M4K4_HUMAN
    • MAP4K4
    • MAPK/ERK kinase kinase kinase 4
    • MEK kinase kinase 4
    • MEKKK 4
    • MEKKK4
    • Mitogen activated protein kinase kinase kinase kinase 4
    • Mitogen-activated protein kinase kinase kinase kinase 4
    • Nck interacting kinase
    • Nck-interacting kinase
    • NIK
    see all
  • Function
    Serine/threonine kinase that may play a role in the response to environmental stress and cytokines such as TNF-alpha. Appears to act upstream of the JUN N-terminal pathway.
  • Tissue specificity
    Appears to be ubiquitous. Expressed in all tissue types examined. Isoform 5 appears to be more abundant in the brain. Isoform 4 is predominant in the liver, skeletal muscle and placenta.
  • Sequence similarities
    Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. STE20 subfamily.
    Contains 1 CNH domain.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab152989 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152989 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152989.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up