Recombinant Human MAPK11 protein (ab117219)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15759
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTVWEVPQRLQGL RPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKH LKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHV QFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSD YIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA NPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESV EAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
    • Molecular weight44 kDa including tags
    • Amino acids1 to 364
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab117219 is purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Human p38Beta MAP kinase mRNA complete cds
    • MAP kinase 11
    • MAP kinase p38 beta
    • MAPK 11
    • Mapk11
    • Mitogen activated protein kinase 11
    • Mitogen activated protein kinase p38 2
    • Mitogen activated protein kinase p38 beta
    • Mitogen-activated protein kinase 11
    • Mitogen-activated protein kinase p38 beta
    • MK11_HUMAN
    • p38 2
    • p38-2
    • p38B
    • p38Beta
    • P38BETA2
    • PRKM11
    • Protein kinase mitogen activated 11
    • SAPK2
    • SAPK2B
    • Stress activated protein kinase 2
    • Stress activated protein kinase 2b
    • Stress-activated protein kinase 2
    see all
  • FunctionKinase involved in a signal transduction pathway that is activated by changes in the osmolarity of the extracellular environment, by cytokines, or by environmental stress. Phosphorylates preferentially transcription factor ATF2.
  • Tissue specificityHighest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similaritiesBelongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • DomainThe TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-180 and Tyr-182, which activates the enzyme.
  • Information by UniProt

Recombinant Human MAPK11 protein images

  • 15% SDS-PAGE showing ab117219 at approximately 43.8kDa (3µg).

References for Recombinant Human MAPK11 protein (ab117219)

ab117219 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab117219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"