Recombinant Human MAPK11 protein (ab117219)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTVWEVPQRLQGL RPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQSLIHARRTYRELRLLKH LKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQALSDEHV QFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSD YIDQLKRIMEVVGTPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGA NPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESV EAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ
    • Molecular weight
      44 kDa including tags
    • Amino acids
      1 to 364
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab117219 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab117219 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names
    • Human p38Beta MAP kinase mRNA complete cds
    • MAP kinase 11
    • MAP kinase p38 beta
    • MAPK 11
    • Mapk11
    • Mitogen activated protein kinase 11
    • Mitogen activated protein kinase p38 2
    • Mitogen activated protein kinase p38 beta
    • Mitogen-activated protein kinase 11
    • Mitogen-activated protein kinase p38 beta
    • MK11_HUMAN
    • p38 2
    • p38-2
    • p38B
    • p38Beta
    • P38BETA2
    • PRKM11
    • Protein kinase mitogen activated 11
    • SAPK2
    • SAPK2B
    • Stress activated protein kinase 2
    • Stress activated protein kinase 2b
    • Stress-activated protein kinase 2
    see all
  • Function
    Kinase involved in a signal transduction pathway that is activated by changes in the osmolarity of the extracellular environment, by cytokines, or by environmental stress. Phosphorylates preferentially transcription factor ATF2.
  • Tissue specificity
    Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Domain
    The TXY motif contains the threonine and tyrosine residues whose phosphorylation activates the MAP kinases.
  • Post-translational
    modifications
    Dually phosphorylated on Thr-180 and Tyr-182, which activates the enzyme.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab117219 at approximately 43.8kDa (3µg).

References

ab117219 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117219.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up