Recombinant Human MAPRE1 protein (ab101824)

Overview

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ15691
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSDNLSRHDMLAWINESLQL NLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR QGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQE NEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
    • Molecular weight32 kDa including tags
    • Amino acids1 to 268
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 90 % SDS-PAGE.
    ab101824 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 5530600P05Rik
    • Adenomatous polyposis coli binding protein EB 1
    • Adenomatous polyposis coli binding protein EB1
    • AI462499
    • AI504412
    • APC binding protein EB 1
    • APC binding protein EB1
    • APC-binding protein EB1
    • AW260097
    • BIM1p
    • D2Ertd459e
    • EB 1
    • EB1
    • End binding protein 1
    • End-binding protein 1
    • fa01e12
    • fc23e11
    • fi33c06
    • MAPRE 1
    • MAPRE1
    • Mapre3
    • MARE1_HUMAN
    • MGC117374
    • MGC129946
    • MGC52508
    • Microtubule associated protein RP/EB family member 1
    • Microtubule-associated protein RP/EB family member 1
    • wu:fa01e12
    • wu:fc23e11
    • wu:fi33c06
    • zgc:55428
    • zgc:77807
    • zgc:85755
    see all
  • FunctionMay be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificityUbiquitously expressed.
  • Sequence similaritiesBelongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • DomainComposed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localizationCytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Associated with the microtubule network at the growing distal tip of microtubules. Also enriched at the centrosome.
  • Information by UniProt

Recombinant Human MAPRE1 protein images

  • 15% SDS-PAGE analysis of ab101824 (3µg)

References for Recombinant Human MAPRE1 protein (ab101824)

ab101824 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab101824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"