Recombinant Human MAPRE1 protein (ab101824)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMAVNVYSTSVTSDNLSRHDMLAWINESLQL NLTKIEQLCSGAAYCQFMDMLFPGSIALKKVKFQAKLEHEYIQNFKILQA GFKRMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKDYDPVAAR QGQETAVAPSLVAPALNKPKKPLTSSSAAPQRPISTQRTAAAPKAGPGVV RKNPGVGNGDDEAAELMQQVNVLKLTVEDLEKERDFYFGKLRNIELICQE NEGENDPVLQRIVDILYATDEGFVIPDEGGPQEEQEEY
    • Molecular weight
      32 kDa including tags
    • Amino acids
      1 to 268
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab101824 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Preservative: None
    Constituents: 10% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 2mM DTT, pH 8.0

General Info

  • Alternative names
    • 5530600P05Rik
    • Adenomatous polyposis coli binding protein EB 1
    • Adenomatous polyposis coli binding protein EB1
    • AI462499
    • AI504412
    • APC binding protein EB 1
    • APC binding protein EB1
    • APC-binding protein EB1
    • AW260097
    • BIM1p
    • D2Ertd459e
    • EB 1
    • EB1
    • End binding protein 1
    • End-binding protein 1
    • fa01e12
    • fc23e11
    • fi33c06
    • MAPRE 1
    • MAPRE1
    • Mapre3
    • MARE1_HUMAN
    • MGC117374
    • MGC129946
    • MGC52508
    • Microtubule associated protein RP/EB family member 1
    • Microtubule-associated protein RP/EB family member 1
    • wu:fa01e12
    • wu:fc23e11
    • wu:fi33c06
    • zgc:55428
    • zgc:77807
    • zgc:85755
    see all
  • Function
    May be involved in microtubule polymerization, and spindle function by stabilizing microtubules and anchoring them at centrosomes. May play a role in cell migration.
  • Tissue specificity
    Ubiquitously expressed.
  • Sequence similarities
    Belongs to the MAPRE family.
    Contains 1 CH (calponin-homology) domain.
    Contains 1 EB1 C-terminal domain.
  • Domain
    Composed of two functionally independent domains. The N-terminal domain forms an hydrophobic cleft involved in microtubule binding and the C-terminal is involved in the formation of mutually exclusive complexes with APC and DCTN1.
  • Cellular localization
    Cytoplasm > cytoskeleton. Cytoplasm > cytoskeleton > centrosome. Associated with the microtubule network at the growing distal tip of microtubules. Also enriched at the centrosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab101824 (3µg)

References

ab101824 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up