Recombinant Human MARCH6 protein (ab160935)

Overview

  • Product name
    Recombinant Human MARCH6 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DTAEEDICRVCRSEGTPEKPLYHPCVCTGSIKFIHQECLVQWLKHSRKEY CELCKHRFAFTPIYSPDMPSRLPIQDIFAGLVTSIGTAIR
    • Amino acids
      2 to 91
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160935 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DOA10
    • Doa10 homolog
    • E3 ubiquitin protein ligase MARCH6
    • KIAA0597
    • MARCH 6
    • MARCH VI
    • MARCHVI
    • Membrane associated RING CH protein VI
    • Membrane associated ring finger (C3HC4) 6
    • Membrane associated RING finger protein 6
    • Protein TEB 4
    • Protein TEB4
    • RING finger protein 176
    • RNF 176
    • RNF176
    • TEB 4
    • TEB4
    see all
  • Relevance
    MARCH6 (Membrane associated RING finger protein 6) belongs to the MARCH family, which contains at least seven membrane associated RING-CH (MARCH)proteins. MARCH proteins are E3 ubiquitin ligases and are located to subcellular membranes.
  • Cellular localization
    Endoplasmic reticulum membrane; Multi pass membrane protein.

Images

  • ab160935 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160935 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160935.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up