Overview

Description

  • NatureRecombinant
  • SourceSaccharomyces cerevisiae
  • Amino Acid Sequence
    • SpeciesHuman
    • SequenceMSMPLHQISAIPSQDAISARVYRSKTKEKEREEQNEKTLGHFMSHSSNIS KAGSPPSAS APAPVSSFSRTSITPSSQDICRICHCEGDDESPLITPCH CTGSLHFVHQACLQQWIKSS DTRCCELCKYEFIMETKLKPLRKWEKLQ MTSSERRKIMCSVTFHVIAITCVVWSLYVLI DRTAEEIKQGQATGILE WPFWTKLVVVAIGFTGGLLFMYVQCKVYVQLWKRLKAYNRVI YVQNCP ETSKKNIFEKSPLTEPNFENKHGYGICHSDTNSSCCTEPEDTGAEIIHV

Associated products

Specifications

Our Abpromise guarantee covers the use of ab88197 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity> 90 % SDS-PAGE.
    ab88197 was purified using affinity chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    Preservative: None
    Constituents: 30% Glycerol, 0.5% Triton-X-100, 50mM HEPES, 30mM Glutathione, 100mM Sodium chloride, 1mM DTT, pH 7.5

General Info

  • Alternative names
    • c MIR
    • c-MIR
    • Cellular modulator of immune recognition
    • E3 ubiquitin protein ligase MARCH8
    • E3 ubiquitin-protein ligase MARCH8
    • MARCH 8
    • MARCH VIII
    • MARCH-VIII
    • MARCH8
    • MARH8_HUMAN
    • Membrane associated RING CH protein VIII
    • Membrane associated ring finger (C3HC4) 8
    • Membrane associated RING finger protein 8
    • Membrane-associated RING finger protein 8
    • Membrane-associated RING-CH protein VIII
    • MIR
    • OTTHUMP00000058921
    • RING finger protein 178
    • RNF178
    see all
  • FunctionE3 ubiquitin-protein ligase that mediates ubiquitination of CD86 and MHC class II proteins, such as HLA-DR alpha and beta, and promotes their subsequent endocytosis and sorting to lysosomes via multivesicular bodies. May also promote ubiquitination and endocytosis of TFRC and FAS.
  • Tissue specificityBroadly expressed. Present in immature dendritic cells (at protein level).
  • PathwayProtein modification; protein ubiquitination.
  • Sequence similaritiesContains 1 RING-CH-type zinc finger.
  • DomainThe RING-CH-type zinc finger domain is required for E3 ligase activity.
  • Cellular localizationCytoplasmic vesicle membrane. Lysosome membrane. Early endosome membrane.
  • Information by UniProt

References for Recombinant Human MARCH8 protein (ab88197)

ab88197 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab88197.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"