Recombinant Human MARCKS protein (ab152508)

Overview

  • Product name
    Recombinant Human MARCKS protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      GAQFSKTAAKGEAAAERPGEAAVASSPSKANGQENGHVKVNGDASPAAAE SGAKEELQANGSAP
    • Molecular weight
      33 kDa including tags
    • Amino acids
      2 to 65

Specifications

Our Abpromise guarantee covers the use of ab152508 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 80 kDa protein
    • 80K L
    • 80K L protein
    • 80K-L protein
    • 80KL
    • 81 kDa protein, light chain
    • light chain
    • MACS
    • MARCKS
    • MARCS
    • MARCS_HUMAN
    • MGC52672
    • myristoylated alanine rich C kinase substrate
    • Myristoylated alanine rich protein kinase C substrate
    • Myristoylated alanine rich protein kinase C substrate (MARCKS, 80K L)
    • Myristoylated alanine-rich C-kinase substrate
    • Phosphomyristin
    • PKCSL
    • PRKCSL
    • Protein kinase C substrate
    • protein kinase C substrate 80 kDa protein light chain
    see all
  • Function
    MARCKS is the most prominent cellular substrate for protein kinase C. This protein binds calmodulin, actin, and synapsin. MARCKS is a filamentous (F) actin cross-linking protein.
  • Sequence similarities
    Belongs to the MARCKS family.
  • Post-translational
    modifications
    Phosphorylation by PKC displaces MARCKS from the membrane. It also inhibits the F-actin cross-linking activity.
  • Cellular localization
    Cytoplasm > cytoskeleton. Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152508 stained with Coomassie Blue.

References

ab152508 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152508.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up