Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIRGRNSATSADEQPHIGNYRLLKTIGKGNFAKVKLARHILTGKEVAVKI IDKTQLNSSSLQKLFREVRIMKVLNHPNIVKLFEVIETEKTLYLVMEYAS GGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKFIVHRDLKAENLLL DADMNIKIADFGFSNEFTFGNKLDTFCGSPPYAAPELFQGKKYDGPEVDV WSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKK FLILNPSKRGTLEQIMKDRWMNVGHEDDELKPYVEPLPDYKDPRRTELMV SMGYTREEIQDSLVGQRYNEVMATYLLLGYKSSELEGDTITLKPRPSADL TNSSAPSPSHKVQRSVSANPKQRRFSDQAAGPAIPTSNSYSKKTQSNNAE NKRPEEDRESGRKASSTAKVPASPLPGLERKKTTPTPSTNSVLSTSTNRS RNSPLLERASLGQASIQNGKDSLTMPGSRASTASASAAVSAARPRQHQKS MSASVHPNKASGLPPTESNCEVPRPSTAPQRVPVASPSAHNISSSGGAPD RTNFPRGVSSRSTFHAGQLRQVRDQQNLPYGVTPASPSGHSQGRRGASGS IFSKFTSKFVRRNLSFRFARRNLNEPESKDRVETLRPHVVGSGGNDKEKE EFREAKPRSLRFTWSMKTTSSMEPNEMMREIRKVLDANSCQSELHEKYML LCMHGTPGHEDFVQWEMEVCKLPRLSLNGVRFKRISGTSMAFKNIASKIA NELKL
    • Amino acids
      1 to 755
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158356 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ELKL motif kinase
    • ELKL motif kinase 1
    • EMK-1
    • EMK1
    • MAP/microtubule affinity regulating kinase 2
    • MAP/microtubule affinity-regulating kinase 2
    • Mark2
    • MARK2_HUMAN
    • MGC99619
    • PAR 1
    • Par 1b
    • PAR1 homolog
    • Par1b
    • Ser/Thr protein kinase PAR 1B
    • Serine/threonine protein kinase EMK
    • Serine/threonine protein kinase MARK2
    • Serine/threonine-protein kinase MARK2
    see all
  • Function
    Role in epithelial morphogenesis. Modulates the developmental decision to build a columnar versus a hepatic epithelial cell apparently by promoting a switch from a direct to a transcytotic mode of apical protein delivery. Essential for the asymmetric development of membrane domains of polarized epithelial cells. One or more isoforms may play a role in graft rejection.
  • Tissue specificity
    High levels of expression in heart, brain, skeletal muscle and pancreas, lower levels observed in lung, liver and kidney.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. MARK subfamily.
    Contains 1 KA1 (kinase-associated) domain.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Cellular localization
    Cell membrane. Phosphorylated by PRKCZ in polarized epithelial cells, resulting in an interaction with YWHAZ which promotes relocation from the lateral to the apical membrane.
  • Information by UniProt

Images

  • ab158356 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158356 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158356.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up