Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GMTRRNTYVCSERTTADRHSVIQNGKENSTIPDQRTPVASTHSISSAATP DRIRFPRGTASRSTFHGQPRERRTATYNGPPASPSLSHEATPLSQTRSRG STNLFSKLTSKLTRSRNVSAEQKDENKEAKPRSLRFTWSMKTTSSMDPGD M
    • Amino acids
      501 to 651
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158859 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C-TAK1
    • Cdc25C associated protein kinase 1
    • Cdc25C-associated protein kinase 1
    • cTAK1
    • ELKL motif kinase 2
    • EMK-2
    • Emk2
    • ETK 1
    • KIAA4230
    • KP78
    • MAP microtubule affinity regulating kinase 3
    • MAP/microtubule affinity-regulating kinase 3
    • Mark3
    • MARK3_HUMAN
    • Par 1a
    • PAR1A
    • Protein kinase STK10
    • Ser/Thr protein kinase PAR-1
    • Serine threonine protein kinase p78
    • Serine/threonine-protein kinase p78
    • SerThr protein kinase PAR 1
    see all
  • Function
    Involved in the specific phosphorylation of microtubule-associated proteins for tau, MAP2 and MAP4. Phosphorylates CDC25C on 'Ser-216'.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. MARK subfamily.
    Contains 1 KA1 (kinase-associated) domain.
    Contains 1 protein kinase domain.
    Contains 1 UBA domain.
  • Information by UniProt

Images

  • ab158859 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158859 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158859.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up