Recombinant Human MARVELD1 protein (ab164437)

Overview

  • Product name
    Recombinant Human MARVELD1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLPPPPRQPPPQARAARGAVRLQRPFLRSPLGVLRLLQLLAGAAFWITIA TSKYQGPVHFALFVSVLFWLLTLGLYFLTLLGKHELVPVLGSRWLMVNVA HDVLAAALYGAATGIMSDQMQRHSYCNLKDYPLPCAYHAFLAAAVCGGVC HGLYLLSALYGCGRRCQGKQEVA
    • Amino acids
      1 to 173
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164437 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • GB14
    • MALD1_HUMAN
    • MARVD1
    • MARVEL (membrane-associating) domain containing 1
    • MARVEL domain containing protein 1
    • MARVEL domain-containing protein 1
    • MARVELD1
    • MRVLDC1
    • Putative MARVEL domain containing protein 1
    see all
  • Function
    Microtubule-associated protein that exhibits cell cycle-dependent localization and can inhibit cell proliferation and migration.
  • Tissue specificity
    Widely expressed in normal tissues. Down-regulated in multiple primary tumors.
  • Sequence similarities
    Contains 1 MARVEL domain.
  • Cellular localization
    Cell membrane. Cytoplasm > cytoskeleton. Nucleus. Observed in the nucleus and at the perinuclear region during interphase, but localizes at the mitotic spindle and midbody at metaphase. A significant fraction of MARVELD1 translocates to the plasma membrane during anaphase or upon microtubule depolymerization.
  • Information by UniProt

Images

  • ab164437 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164437 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164437.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up