Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMVVLSVPAEVTVILLDIEGTTTPIAFVKDI LFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASG NGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAE FFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHF DTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVV VRPGNAGLTDDEKTYYSLITSFSELYLPSST
    • Molecular weight
      31 kDa including tags
    • Amino acids
      1 to 261
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab105128 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab105128 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 10% Glycerol, 20mM Tris HCl, 100mM Sodium chloride, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • 2
    • 2 3 diketo 5 methylthio 1 phosphopentane phosphatase
    • 3-diketo-5-methylthio-1-phosphopentane phosphatase
    • Acireductone synthase
    • DKFZp586M0524
    • E 1 enzyme
    • E1
    • Enolase phosphatase 1
    • Enolase phosphatase E1
    • Enolase-phosphatase E1
    • ENOPH_HUMAN
    • Enoph1
    • FLJ12594
    • MASA homolog
    • MST145
    • MSTP145 protein
    see all
  • Function
    Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
  • Pathway
    Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 3/6.
    Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 4/6.
  • Sequence similarities
    Belongs to the HAD-like hydrolase superfamily. MasA/MtnC family.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Recombinant Human MASA protein images

  • 15% SDS-PAGE showing ab105128 at approximately 31kDa (3µg).

References for Recombinant Human MASA protein (ab105128)

ab105128 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab105128.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up